Anti-FADD

Application

Rabbit Anti-FADD (AB2) antibody is suitable for use in western blot (0.25µg/ml) assays.

Biochem/physiol Actions

Fadd is apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FADD is a death domain-containing protein that associates with fas and mediates apoptosis. Rabbit Anti-FADD (AB2) antibody binds to mouse FADD.

Immunogen

Synthetic peptide directed towards the C terminal region of mouse FADD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP