Anti-TRHR

Application

Anti-TRHR antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Biochem/physiol Actions

Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that binds to Thyrotropin-releasing hormone receptor. It subsequently stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TRHR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSD