SILU(TM)PROT IGF-1 INSULIN GROWTH FACTO

Code: msst0063-10ug D2-231

Biochem/physiol Actions

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar i...


 Read more

Your Price
€734.18 10UG
€903.04 inc. VAT

Biochem/physiol Actions

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

General description

SILuProt IGF-1 is a recombinant, stable 15N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILuProt IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

assay≥95% (SDS-PAGE)
formlyophilized
potency≥97% (Heavy amino acids incorporation efficiency by MS)
Quality Level200
recombinantexpressed in E. coli
shipped inambient
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
UniProt accession no.P05019 (Gly49-Ala118)
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.