SILu(TM) Prot IL6 Interleukin 6 human

Code: msst0017-10ug D2-231

Biochem/physiol Actions

IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated c...


 Read more

Your Price
€756.93 10UG
€931.02 inc. VAT

Biochem/physiol Actions

IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.

General description

SILu Prot IL-6 is a recombinant, stable isotope-labeled human IL-6 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IL-6 in mass-spectrometry. SILu Prot IL-6 is a monomer of 183 amino acids, with a molecular weight of ~21 kDa. Suggested Quantitative Analysis Parameters (MRM settings provided for three suggested peptides)

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

assay98% (SDS-PAGE)
biological sourcehuman
formlyophilized powder
Gene Informationhuman ... IL6(3569)
potency≥98% Heavy amino acids incorporation efficiency by MS
Quality Level200
recombinantexpressed in HEK 293 cells
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
technique(s)mass spectrometry (MS): suitable
UniProt accession no.P05231
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.