SILu(TM) Lite MAPK1 human

Code: msst0010-50ug D2-231

Biochem/physiol Actions

MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear prot...


 Read more

Your Price
€756.93 50UG
€931.02 inc. VAT

Biochem/physiol Actions

MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.

General description

SILuLite MAPK1 is a recombinant human MAPK1 expressed in human 293 cells. It is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa. SILuLite MAPK1 is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.

Sequence

MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

assay≥95% (SDS-PAGE)
formliquid
mol wt43.8 kDa
Quality Level200
recombinantexpressed in HEK 293 cells
relevant disease(s)cancer
storage temp.−20°C
suitabilitysuitable for mass spectrometry (internal calibrator)
tagHis tagged
UniProt accession no.P28482
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.