Analysis Note
QuantitativeMRM settings provided (xls)
Application
Poster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards
General description
SILu™ MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4. SILu™ MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.
Immunogen
SILu™Mab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGSILu™Mab Adalimumab Light Chain: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
Preparation Note
Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.SILu™Mab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.
Reconstitution
Each vial of SILu™Mab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
SILu™Mab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution. Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial. Add 500 µL of ultrapure water containing 0.1% formic acid to the vial. Mix the contents by gently inverting the vial a minimum of 5 times. Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.
Sequence
Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic DigestUniversal Peptide Sequence LocationGLEWVSAITWNSGHIDYADSVEGR Heavy chainAPYTFGQGTK Light chainFSGSGSGTDFTLTISSLQPEDVATYYCQR Light chain
This product has met the following criteria to qualify for the following awards: