PSF-TEF1-COOH-MBP - C-TERMINAL MBP TAG YEAST PLASMID; plasmid vector for molecular cloning

Code: OGS3465-5UG D2-231

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxfordgenetics.com.

General description

This plasmid is desi...


read more

Your Price
€417.30 5UG
Discontinued
€513.28 inc. VAT

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxfordgenetics.com.

General description

This plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil. About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. About the Cleavage Tag:This plasmid does not contain a protease cleavage site. Promoter Expression Level: PSF-TEF1-COOH-MBP - C- terminal MBP tag yeast plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.GD-PSF-TEF1-COOH-MBP - C- terminal MBP affinity tag yeast plasmid vector allows the creation of tag fusion proteins with no protease cleavage tag.

Legal Information

Oxford Genetics is a trademark of Oxford Genetics Ltd

Other Notes

Looking for more vector options to move your experiments forward faster? Consider a custom cloning vector designed and built by Oxford Genetics. Find out more at Oxford Genetics - Sigma's partner for cloning and expression vectors for molecular biology and synthetic biology applications.

Sequence

Quick-reference Plasmid Map

Please select the file type you require. For reference most cloning programs will import a .gb (Genbank) file and will show all of the plasmids features automatically when downloaded and imported.Genebank Vector Sequence FileFASTA Vector Sequence FileFull Plasmid Map

bacteria selectionkanamycin
formbuffered aqueous solution
mol wtsize 7821 bp
origin of replication2Micron, pUC (500 copies)
peptide cleavageno cleavage
peptide tag locationC-terminal
promoterPromoter name: TEF1Promoter activity: constitutivePromoter type: yeast
reporter genenone
shipped inambient
storage temp.−20°C
tagmaltose-binding protein (MBP) tagged
yeast selectionuracil
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.