Anti-GRHL1

Code: sab2100971-100ul D2-231

Biochem/physiol Actions

GRHL1 is a member of the grainyhead family of transcription factors. GRHL1 interacts with sister of mammalian grainyhead (SOM) and may function as a t...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Biochem/physiol Actions

GRHL1 is a member of the grainyhead family of transcription factors. GRHL1 interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for GRHL1.This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GRHL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GRHL1(29841)
mol wt70 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, horse, bovine, dog, mouse, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NZI5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.