Anti-ISYNA1

Code: av53716-100ul D2-231

Application

Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Applications in which this antibody has been use...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)

Biochem/physiol Actions

ISYNA1 (inositol-3-phosphate synthase 1) gene encodes a protein that belongs to myo-inositol 1-phosphate synthase family and is predominantly expressed in testis, ovary, heart, placenta and pancreas. It is a crucial enzyme in myo-inositol biosynthesis pathway that plays a pivotal role in catalyzing the rate-limiting conversion of glucose 6-phosphate to myoinositol 1-phosphate.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ISYNA1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ISYNA1(51477)
mol wt61 kDa
NCBI accession no.NP_057452
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NPH2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.