Anti-POLK

Code: av48793-100ul D2-231

Application

Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

POLK b...


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.

Immunogen

Synthetic peptide directed towards the middle region of human POLK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... POLK(51426)
mol wt99 kDa
NCBI accession no.NP_057302
Quality Level100
shipped inwet ice
species reactivitymouse, rat, human, horse, pig, dog, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UBT6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.