Anti-LMAN2

Code: av46788-100ul D2-231

Application

Anti-LMAN2 (AB1) polyclonal antibody is used to tag lectin, mannose-binding 2 for detection and quantitation by Western blotting and in plasma by immunohistochemi...


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Anti-LMAN2 (AB1) polyclonal antibody is used to tag lectin, mannose-binding 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of lectin, mannose-binding 2 in the secretion of high mannose glycoproteins.

Biochem/physiol Actions

LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Lectin, mannose-binding 2 (LMAN2, VIP36) is an intracellular, integral membrane protein that functions as a lectin of the post-Golgi secretory pathway. LMAN2 facilitates the secretion of high mannose glycoproteins predominantly via the apical surface of cells.

Immunogen

Synthetic peptide directed towards the N terminal region of human LMAN2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

Specificity

Anti-LMAN2 (AB1) polyclonal antibody reacts with zebrafish, bovine, human, rat, canine, and mouse lectin, mannose-binding 2 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LMAN2(10960)
mol wt36 kDa
NCBI accession no.NP_006807
Quality Level100
shipped inwet ice
species reactivitymouse, human, dog, horse, rabbit, bovine, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q12907
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.