Anti-CBS

Code: av45746-100ul D2-231

Biochem/physiol Actions

Cystathionine β-synthase (CBS) is an important enzyme in the transsulfuration metabolic pathway. It transforms homocysteine to cystathionine, which is...


 Read more

Your Price
€400.00 100UL
€492.00 inc. VAT

Biochem/physiol Actions

Cystathionine β-synthase (CBS) is an important enzyme in the transsulfuration metabolic pathway. It transforms homocysteine to cystathionine, which is then converted to cysteine, required for production of the chief retinal antioxidant glutathione (GSH).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CBS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CBS(875)
mol wt60 kDa
NCBI accession no.NP_000062
Quality Level100
shipped inwet ice
species reactivityguinea pig, horse, bovine, rabbit, human, rat, mouse, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P35520
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.