Anti-SLC39A5

Code: av44143-100ul D2-231

Application

Anti-SLC39A5 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml and for immunohistochemistry of paraffin-embed...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Anti-SLC39A5 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

SLC39A5 (ZIP5) is a zinc uptake transporter that specifically transports Zn+2 ions. It is expressed in intestine, pancreas, liver and kidney. ZIP5 maintains zinc homeostasis and plays an important role in the uptake of dietary zinc across apical membrane of enterocytes in the intestine. Zinc transport by ZIP5 is important to protect the pancreatic acinar cells against zinc toxicity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC39A5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC39A5(283375)
mol wt56 kDa
NCBI accession no.NP_001128667
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q6ZMH5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.