Anti-RRN3

Code: av34462-100ul D2-231

Biochem/physiol Actions

RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of g...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Biochem/physiol Actions

RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth..

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

RRN3 is conserved between yeast and humans. It is required for transcription initiation by RNA polymerase 1 where it assists in formation of the preinitiation complex.

Immunogen

Synthetic peptide directed towards the C terminal region of human RRN3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RRN3(54700)
mol wt74 kDa
NCBI accession no.NP_060897
Quality Level100
shipped inwet ice
species reactivityyeast, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NYV6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.