Anti-POU4F3

Code: av33065-100ul D2-231

Biochem/physiol Actions

POU4F3 is capable of activating both BDNF and NT-3 promoters in inner ear sensory epithelial cell lines. Mutant POU4F3 loses most of its transcription...


 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Biochem/physiol Actions

POU4F3 is capable of activating both BDNF and NT-3 promoters in inner ear sensory epithelial cell lines. Mutant POU4F3 loses most of its transcriptional activity and most of its ability to bind to DNA. The mutation causes autosomal-dominant nonsyndromic hearing loss and eventually leads to hair cell morbidity in affected family members.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human POU4F3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... POU4F3(5459)
mol wt37 kDa
NCBI accession no.NP_002691
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, guinea pig, mouse, bovine, dog, human, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q15319
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.