Anti-NPAS1

Code: av32053-100ul D2-231

Application

Rabbit Anti-NPAS1 antibody can be used for western blotting at 2µg/ml. It can also be used for IHC at 4-8µg/ml, using paraffin-embedded tissues.

<...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Rabbit Anti-NPAS1 antibody can be used for western blotting at 2µg/ml. It can also be used for IHC at 4-8µg/ml, using paraffin-embedded tissues.

Biochem/physiol Actions

NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NPAS1 is a basic helix-loop-helix transcription factor that that regulates branching morphogenesis in mouse embryonic lung tissues. Studies in mice have reported that NPAS1 deficiency can result in behavioural and functional abnormalities.Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.

Immunogen

Synthetic peptide directed towards the C terminal region of human NPAS1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NPAS1(4861)
mol wt63 kDa
NCBI accession no.NP_002508
Quality Level100
shipped inwet ice
species reactivityrabbit, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q99742
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.