ANTI-GADD45B

Code: SAB2108614-100UL D2-231

Biochem/physiol Actions

sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintai...


 Read more

Your Price
€519.00 100UL
€638.37 inc. VAT

Biochem/physiol Actions

sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintain chondrocyte homeostasis by regulating the expression of collagen gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Growth arrest and DNA damage-inducible 45 (GADD45B) gene is located on human chromosome 19p13.3.

Immunogen

Synthetic peptide directed towards the middle region of human GADD45B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

accession no.NM_015675
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GADD45B(4616)
mol wt18 kDa
Quality Level100
shipped inwet ice
species reactivitymouse, horse, human, dog, rat, bovine, pig
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.O75293
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.