Anti-KIAA0226

Code: SAB2107356-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
€566.00 100UL
€696.18 inc. VAT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human KIAA0226

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KIAA0226(9711)
mol wt103 kDa
NCBI accession no.NM_001145642
Quality Level100
shipped inwet ice
species reactivityhuman, rat
storage temp.−20°C
technique(s)western blot: suitable
This product has met the following criteria: