Anti-CBX1

Biochem/physiol Actions

CBX1 is the component of heterochromatin. CBX1 recognizes and binds histone H3 tails methylated at ′Lys-9′, leading to epigenetic repression. CBX1 interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the in

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CBX1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN