Anti-ENDOG

Code: SAB2103518-100UL D2-231

Application

Anti-ENDOG antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

ENDOG cleaves DNA at double-str...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-ENDOG antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human ENDOG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ENDOG(2021)
mol wt28 kDa
NCBI accession no.NM_004435
Quality Level100
shipped inwet ice
species reactivityhorse, mouse, guinea pig, human, rat, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q14249
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.