Anti-SIX2

Code: SAB2103006-100UL D2-231

Biochem/physiol Actions

This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila ′sine oculis′ homeobox protein. SIX...


 Read more

Your Price
€381.00 100UL
€381.00 inc. VAT

Biochem/physiol Actions

This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila ′sine oculis′ homeobox protein. SIX2 is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SIX2(10736)
mol wt32 kDa
NCBI accession no.NM_016932
Quality Level100
shipped inwet ice
species reactivitymouse, human, horse, bovine, guinea pig, dog, rat, sheep, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NPC8
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.