Anti-TCF7L2

Code: SAB2102397-100UL D2-231

Biochem/physiol Actions

The TCL7L2 is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. suggeste...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Biochem/physiol Actions

The TCL7L2 is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. suggested that TCL7L2 acts through regulation of proglucagon through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. The TCL7L2 gene product is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. (2005) [PubMed 15525634] suggested that TCL7L2 acts through regulation of proglucagon (MIM 138030) through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway.[supplied by OMIM]. Sequence Note: This gene (TCF7L2, alias TCF-4) is distinct from TCF4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-202 DA473655.1 1-202 203-251 Y11306.2 3-51 252-1252 AK225809.1 256-1256 1253-1305 Y11306.2 1053-1105 1306-1756 AK225809.1 1310-1760 1757-1811 Y11306.2 1557-1611 1812-2652 AK225809.1 1765-2605

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TCF7L2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TCF7L2(6934)
mol wt65 kDa
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6FHW4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.