Anti-LOXL1

Code: AV54780-100UL D2-231

Application

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

Th...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

The encoded protein belongs to lysyl oxidase gene family and is mapped on to chromosome 15 at 15q24-q25. It is an extracellular protein with elastin and collagen as the chief substrates. It plays a crucial role in oxidizing the epsilon (ε) amino group in lysine to produce an aldehyde group. Lysyl oxidases are copper amine oxidases that facilitate the biogenesis of connective tissue by initiating the covalent crosslinking between collagens and elastin. Defect in LOXL1 gene expression is associated with exfoliation disease development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human LOXL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LOXL1(4016)
mol wt63 kDa
NCBI accession no.NP_005567
Quality Level100
shipped inwet ice
species reactivityrat, guinea pig, mouse, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q08397
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.