AV54569-100UL Display Image

Anti-EPB41L2

Code: AV54569-100UL D2-231

Application

Anti-EPB41L2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

...


read more

Your Price
€577.00 100UL
€709.71 inc. VAT

Application

Anti-EPB41L2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

The protein encoded by this gene interacts with the C-terminus of G protein-coupled receptors (GPCRs) and regulates intracellular distribution of the receptors, including parathyroid hormone.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene EPB41L2 maps to human chromosome 6q23 and is widely expressed among human tissues. The gene encodes a 113-kDa protein that exhibits three regions of high homology to EPB41, including the membrane binding domain, the spectrin–actin binding domain, and the C-terminal domain.

Immunogen

Synthetic peptide directed towards the middle region of human EPB41L2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EPB41L2(2037)
mol wt66 kDa
NCBI accession no.NP_001129026
Quality Level100
shipped inwet ice
species reactivitymouse, guinea pig, rat, horse, dog, bovine, human, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O43491
This product has met the following criteria: