Anti-PELI3

Application

Anti-PELI3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

The gene PELI3 encodes a scaffold protein involved in TLR (Toll-like receptor)/IL-1R (IL-1 receptor) signalling pathways that shape innante immunity via interaction with the complex containing IRAK kinases and TRAF6. This leads to nuclear factor-κB and mitogen activated protein kinase-dependent gene expression. The pellino protein also induces IRAK-1 polyubiquitination in a RING-dependent manner, which in turn regulates TLR/IL-1R signalling. Pellino3 targets the interferon regulatory factor 7 pathway and facilitates autoregulation of toll-like receptors (TLR3)- and viral-induced expression of type I interferons.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PELI3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG