Anti-CDKN3

Code: AV53629-100UL D2-231

Application

Anti-CDKN3 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/ml.

Biochem/physiol Actions

Cy...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-CDKN3 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/ml.

Biochem/physiol Actions

Cyclin-dependent kinase inhibitor 3 (CDKN3) regulates the mitosis through the CDC2 signaling axis. CDKN3 also possess the capability to interact with multiple cyclin-dependent kinases and hence may facilitate the cell cycle regulation. Increased expression of CDKN3 enhances the kinase-associated phosphatase activity that inhibits the G1/S transition of the cell cycle by dephosphorylating the cyclin dependent kinases. It promotes tumour genesis. It may play an important role in the development and proliferation of epithelial ovarian cancer (EOC).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Cyclin-dependent kinase inhibitor 3 is an enzyme encoded by the CDKN3 gene in humans. CDKN3 (cyclin-dependent kinase inhibitor 3) gene also referred to as CDI1, CIP2, FLJ25787, KAP1, KAP or MGC70625 encodes a protein that belongs to dual specificity protein phosphatase family.

Immunogen

Synthetic peptide directed towards the C terminal region of human CDKN3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CDKN3(1033)
mol wt23 kDa
NCBI accession no.NP_001124323
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q16667
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.