Anti-MICALL1

Code: AV51692-100UL D2-231

Application

Anti-MICALL1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-MICALL1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

Molecule Interacting with CasL (MICAL)-like1 (MICALL1) is an endocytic regulatory protein that interacts with GTP-binding proteins such as Rab35. This interaction enhances the localization of MICALL1 to tubular recycling endosomes. MICALL1 also interacts with Rab13 and mediates the endocytosis of epidermal growth factor and regulates assembly of tight junction in the epithelial cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human MICALL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MICALL1(85377)
mol wt93 kDa
NCBI accession no.NP_203744
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q8N3F8
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.