Anti-ZNF385B

Code: AV50803-100UL D2-231

Application

Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

<...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Zinc finger protein 385B (ZNF385B; ZNF533) is a transcription factor. ZNF385B modulates transactivation of p53 and is involved in B-cell apoptosis. The expression of ZNF385B correlates with survival in ovarian carcinomas. Single nucleotide polymorphism in ZNF385B is associated with autism. Similarly, polymorphism in ZNF385B is also linked to nonsyndromic orofacial clefts (NSOC).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31.3. It contains 4 matrin-type zinc fingers. It is present in the germinal center of lymph nodes. ZNF385B is expressed in spleen, lymph node and tonsil.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZNF385B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNF385B(151126)
mol wt41 kDa
NCBI accession no.NP_001106868
Quality Level100
shipped inwet ice
species reactivitymouse, guinea pig, bovine, rat, dog, horse, human, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q569K4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.