Anti-TMEM126B

Application

Anti-TMEM126B antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Transmembrane protein 126B (TMEM126B; HT007) is a component of mitochondrial complex I and is essential for the assembly and constructing the membrane arm of the complex. Mitochondrial complex I mediates electron entry from NADH into the electron transport chain.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TMEM126B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC