Anti-GSTZ1

Code: AV49036-100UL D2-231

Application

Anti-GSTZ1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Anti-GSTZ1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml.

Biochem/physiol Actions

Glutathione S-transferase zeta 1 (GSTZ1) belongs to glutathione S-transferase (GSTs) super-family involved in detoxification of carcinogens and drugs by conjugation with glutathione. GSTZ1 is also involved in the metabolism of phenylalanine and tyrosine. Defects in GSTZ1 gene result in metabolic disorders such as phenylketonuria, alkaptonuria and tyrosinaemia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GSTZ1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GSTZ1(2954)
mol wt24 kDa
NCBI accession no.NP_665878
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, dog, rabbit, pig, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O43708
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.