Application
Anti-CORIN antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/mL.
Biochem/physiol Actions
CORIN gene encodes for a single-pass type II membrane protein. It is a transmembrane cardiac serine protease that plays a pivotal role in converting pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide that regulates blood volume and pressure. In pregnant female, it stimulates the trophoblast invasion and spiral artery remodeling in uterus. Additionally, soluble corin facilitates as a potent biomarker for heart failure (HF).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human CORIN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
This product has met the following criteria to qualify for the following awards: