Anti-XTP3TPA

Application

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5µg/ml. It has also been used for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

XTP3TPA (XTP3-transactivated protein A) also referred as DCTPP1 or RS21C6 is a 170 amino acid protein expressed in embryonic and highly proliferating cells primarily in liver, kidney, ovary and testis with particularly high expression in cancer cells.DCTPP1 hydrolyses 5-formyl-dCTP and plays a crucial role in the balance of dCTP as well as facilitates the metabolism of deoxycytidine analogs; hence contribute to the preservation of genome integrity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human XTP3TPA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST