Anti-XTP3TPA

Code: AV46329-100UL D2-231

Application

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5µg/ml. It has also been used for immunohistochemis...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5µg/ml. It has also been used for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

XTP3TPA (XTP3-transactivated protein A) also referred as DCTPP1 or RS21C6 is a 170 amino acid protein expressed in embryonic and highly proliferating cells primarily in liver, kidney, ovary and testis with particularly high expression in cancer cells.DCTPP1 hydrolyses 5-formyl-dCTP and plays a crucial role in the balance of dCTP as well as facilitates the metabolism of deoxycytidine analogs; hence contribute to the preservation of genome integrity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human XTP3TPA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... XTP3TPA(79077)
mol wt19 kDa
NCBI accession no.NP_077001
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9H773
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.