AV40961-100UL Display Image

Anti-SF4

Code: AV40961-100UL D2-231

Application

Anti-SF4 polyclonal antibody is used to tag splicing factor 4/SURP and G patch domain containing 1 for detection and quantitation by Western blotting and in plasm...


read more

Your Price
€577.00 100UL
€709.71 inc. VAT

Application

Anti-SF4 polyclonal antibody is used to tag splicing factor 4/SURP and G patch domain containing 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 4/SURP and G patch domain containing 1 in spliceosome formation and function.

Biochem/physiol Actions

SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Splicing factor 4/SURP and G patch domain containing 1 (SF4, RBP, SUGP1) is closely related to SFRS14 (arginine/serine-rich splicing factor 4) which is a potential normalization protein for gene expression studies in HCV-induced hepatocellular carcinoma (HCC).

Immunogen

Synthetic peptide directed towards the N terminal region of human SF4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM

Specificity

Anti-SF4 polyclonal antibody reacts with canine, bovine, zebrafish, human, mouse, and rat splicing factor 4/SURP and G patch domain containing 1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SF4(57794)
mol wt72 kDa
NCBI accession no.NP_757386
Quality Level100
shipped inwet ice
species reactivityguinea pig, human, horse, bovine, dog, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IWZ8
This product has met the following criteria: