Anti-SARS

Code: AV40654-100UL D2-231

Application

Anti-SARS (AB1) polyclonal antibody is used to tag cytosolic seryl-tRNA synthetase for detection and quantitation by Western blotting and in plasma by immunohisto...


read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Anti-SARS (AB1) polyclonal antibody is used to tag cytosolic seryl-tRNA synthetase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of cytosolic seryl-tRNA synthetase in tRNA serine acylation and translation

Biochem/physiol Actions

SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

tRNAs are aminoacylated by the aminoacyl-tRNA synthetases. Due to redundancy of the genetic code, which allows for 64 mRNA codons, tRNA isoacceptors exist that may be aminoacylated with one amino acid but differ in their anticodons. Seryl-tRNA synthetase (SARS) is an enzyme that aminoacylates target tRNA with serine. Seryl-tRNA-synthetase interacts with the tRNA(Ser) acceptor stem, which makes this part of the tRNA a valuable structural element for investigating motifs of the protein-RNA complex. Cytosolic seryl-tRNA synthetase (hsSerRS) is responsible for the covalent attachment of serine to its cognate tRNA(Ser).

Immunogen

Synthetic peptide directed towards the C terminal region of human SARS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL

Specificity

Anti-SARS (AB1) polyclonal antibody reacts with canine, zebrafish, chicken, human, mouse, rat, and bovine cytosolic seryl-tRNA synthetases.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SARS(6301)
mol wt57 kDa
NCBI accession no.NP_006504
Quality Level100
shipped inwet ice
species reactivityrabbit, human, horse, rat, guinea pig, mouse, dog, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5T5C8
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.