Anti-PRKRA

Code: AV40475-100UL D2-231

Application

Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-ind...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing.

Biochem/physiol Actions

PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA).

Immunogen

Synthetic peptide directed towards the middle region of human PRKRA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

Specificity

Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PRKRA(8575)
mol wt34 kDa
NCBI accession no.NP_001132989
Quality Level100
shipped inwet ice
species reactivityhuman, horse, bovine, dog, guinea pig, rabbit, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O75569
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.