Anti-ZNF307

Code: AV39385-100UL D2-231

Application

Rabbit Anti-ZNF307 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-ZNF307 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF307 (ZKSCAN4) is a zinc finger protein that has SCAN and KRAB domains. This protein is known to interact with glucocorticoid receptor.Rabbit Anti- ZNF307 antibody recognizes bovine, human, mouse, and rat ZNF307.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZNF307

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNF307(387032)
mol wt62 kDa
NCBI accession no.NP_061983
Quality Level100
shipped inwet ice
species reactivityrat, human, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q969J2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.