Anti-ZHX2

Code: AV39156-100UL D2-231

Application

Rabbit Anti-ZHX2 antibody is suitable for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

The m...


 Read more

Your Price
€297.00 100UL
€297.00 inc. VAT

Application

Rabbit Anti-ZHX2 antibody is suitable for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. ZHX2 is the member 2 of this gene family. In addition to forming homodimers,this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZHX2 belongs to the zinc fingers and homeoboxes gene family and is involved in transcriptional regulation. It forms heterodimers with ZHX3. ZHX2 represses α-fetoprotein (AFP) expression in human hepatoma cells.Rabbit Anti-ZHX2 antibody recognizes bovine, human, and canine ZHX2.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZHX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZHX2(22882)
mol wt92 kDa
NCBI accession no.NP_055758
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y6X8
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.