Anti-RUNX1

Code: AV38073-100UL D2-231

Application

Anti-RUNX1 antibody produced in rabbit is suitable for western blot.

Biochem/physiol Actions

RUNX1 (Runt-related transcription factor...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-RUNX1 antibody produced in rabbit is suitable for western blot.

Biochem/physiol Actions

RUNX1 (Runt-related transcription factor 1) plays a vital role in tumour suppression and oncogenic activities. In hematopoiesis, it is involved in hematopoietic development, hematopoietic stem cell homeostasis, and various blood malignancies. It may have clinicopathological impact on the proliferation of human bone marrow cells used in transplantation therapy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Runt-related transcription factor 1 (RUNX1) is a transcription factor that plays an important role in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). It was first identified as a component of Polyomavirus enhancer binding protein 2 (PEBP2) and Moloney murine leukemia virus enhancer core binding factor (CBF). Three isoforms of the protein have been identified: RUNX1a, RUNX1b and RUNX1c. Structurally, it consists of Runt domain at the N-terminal region.

Immunogen

Synthetic peptide directed towards the N terminal region of human RUNX1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTALSPGKMSEALPLGAP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RUNX1(861)
mol wt12 kDa
NCBI accession no.NP_001001890
Quality Level100
shipped inwet ice
species reactivityrabbit, bovine, dog, rat, mouse, guinea pig, horse, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q01196
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.