Anti-ZHX2

Code: AV37629-100UL D2-231

Biochem/physiol Actions

ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indire...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Biochem/physiol Actions

ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of mouse ZHX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationmouse ... ZHX2(387609)
mol wt92 kDa
NCBI accession no.NP_955520
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8C0C0
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.