Anti-DDX5

Code: AV36366-100UL D2-231

Application

Anti-DDX5 (AB2) antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

DEAD (Asp-Glu-Ala-Asp) box...


 Read more

Your Price
€297.00 100UL
€297.00 inc. VAT

Application

Anti-DDX5 (AB2) antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

DEAD (Asp-Glu-Ala-Asp) box helicase 5 (DDX5) is a member of putative RNA helicases called the DEAD box proteins. It is involved in regulation of RNA secondary structure during translation initiation, nuclear and mitochondrial splicing and ribosome and spliceosome assembly. DDX5 is a RNA-dependent ATPase and a proliferation-associated nuclear antigen that is a master regulator of estrogen- and androgen-mediated signaling pathways.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

DDX5 (DEAD, Asp-Glu-Ala-Asp, box helicase 5) is a multifunctional protein belonging to the DEAD box family of RNA helicases. It consists of twelve conserved motifs (including the signature D-E-A-D motif) forming a conserved ′helicase′ central domain, which plays an important role in the RNA metabolism.

Immunogen

Synthetic peptide directed towards the N terminal region of human DDX5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DDX5(1655)
mol wt68 kDa
NCBI accession no.NP_004387
Quality Level100
shipped inwet ice
species reactivitybovine, guinea pig, rat, horse, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P17844
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.