Anti-CSRP3

Application

Rabbit Anti-CSRP3 can be used for western blot applications at 0.125 µg/ml.

Biochem/physiol Actions

This CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CSRP3 is a LIM domain protein that may modulate cell growth and differentiation. Studies in rat wheel-lock (WL) models for depressed ambulatory activity have revealed low Csrp3 protein levels. Moreover, CSRP3 mutations have been linked to hypertrophic cardiomyopathy.Rabbit Anti-CSRP3 recognizes human, canine, rat, mouse, bovine, and pig CSRP3.

Immunogen

Synthetic peptide directed towards the C terminal region of human CSRP3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE