Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)Immunocytochemistry (1 paper)Western Blotting (1 paper)
Biochem/physiol Actions
GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human GTF2IRD1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQV
This product has met the following criteria to qualify for the following awards: