Application

Rabbit Anti-CHX10 antibody can be used for western blot applications at a concentration of 0.5µg/ml.

Biochem/physiol Actions

Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CHX10 is a retinal homeo domain-containing protein. Mutations in CHX10 have been liked to human microphthalmia/anophthalmia.Rabbit Anti-CHX10 antibody recognizes human, mouse, and canine CHX10.

Immunogen

Synthetic peptide directed towards the C terminal region of human CHX10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM