Anti-CREB1

Code: AV31264-100UL D2-231

Application

Rabbit Anti-CREB1 antibody is suitable for use in western blot applications at 1.25µg/ml.

Biochem/physiol Actions

CREB1 is a tra...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-CREB1 antibody is suitable for use in western blot applications at 1.25µg/ml.

Biochem/physiol Actions

CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway.This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CREB1 is a leucine zipper transcription factor that interacts with cAMP-responsive element. Rabbit Anti-CREB1 antibody recognizes human, mouse, rat, bovine, and canine CREB1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CREB1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQES

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CREB1(1385)
mol wt37 kDa
NCBI accession no.NP_004370
Quality Level100
shipped inwet ice
species reactivityhorse, mouse, dog, rabbit, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P16220
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.