Anti-NFYA

Code: AV31263-100UL D2-231

Application

Rabbit Anti-NFYA antibody can be used for immunohistochemistry (4-8µg/ml using paraffin-embedded tissues) and western blot (5-8µg/ml) applications.

<...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-NFYA antibody can be used for immunohistochemistry (4-8µg/ml using paraffin-embedded tissues) and western blot (5-8µg/ml) applications.

Biochem/physiol Actions

NFYA is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NFYA is a nuclear transcription factor that forms a regulatory subunit of the trimeric complex of NF-Y that associates with CCAAT motifs in cell cycle progression genes. Hence, this gene has been implicated in cell proliferation. Furthermore, NFYA can also facilitate the self-renewal of hematopoietic stem cells (HSCs).Rabbit Anti-NFYA antibody recognizes canine, chicken, human, mouse, rat, and bovine NFYA.

Immunogen

Synthetic peptide directed towards the C terminal region of human NFYA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NFYA(4800)
mol wt37 kDa
NCBI accession no.NP_068351
Quality Level100
shipped inwet ice
species reactivityrat, horse, mouse, human, rabbit, guinea pig, dog, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P23511
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.