Application

Anti-PMCH antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Biochem/physiol Actions

PMCH is expressed by neurons, macrophages, T cells, Sertoli cells and spermatogonia in mammals. It is acted upon by the enzyme proconvertase2 to produce Melanin-concentrating hormone (MCH) and neuropeptide EI (NEI). PMCH expressed by Th2 cells may link the allergic inflammation to energy homeostasis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PMCH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL