Application
Anti-PC4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.
Biochem/physiol Actions
PC4 is a chromatin associated protein that contains a non-specific DNA-binding domain. It is involved in processes of replication, transcription and DNA repair. It exhibits a complex role with negative and positive effects on gene expression by influencing transcription initiation, elongation, termination and reinitiation processes. It stimulates ligase-mediated DNA end joining and activates double-strand break (DSB) repair activity. PC4 is a positive activator of p53 and is overexpressed during genotoxic insult to the cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human PC4
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
This product has met the following criteria to qualify for the following awards: