Application

Anti-FOXO1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Biochem/physiol Actions

FoxO1 mediates the signaling pathways that are involved in glucose metabolism. It is highly expressed in pancreas, liver, adipose and skeletal muscle tissue. The main role of FoxO1 is the maintenance of energy homeostasis during fasting, glycemic control and regulate the breakdown of carbohydrates. FoxO1 is a critical energy and nutrient regulator and is conserved across species.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The FOXO family of transcription factors mediates the interplay between the PI3K-Akt and TOR signaling. The PI3K-Akt-FoxO signaling axis has direct role in cell proliferation, oxidative stress, tumorigenesis and physiological processes.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXO1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA