Anti-TP53

Code: AV02055-100UL D2-231

Application

Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Applications in which this antibody has been used...


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Application

Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)

Biochem/physiol Actions

TP53 is a tumor suppressor protein essential for protection against development of cancer. Mutations in the TP53 gene or alterations in function of the protein result in predisposition to colorectal cancer, gastric and esophageal cancers. TP53 also acts as a transcription factor and maintains the genetic stability preventing malignant transformation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human TP53

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TP53(7157)
mol wt44 kDa
NCBI accession no.NP_000537
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P04637
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.