Biochem/physiol Actions
HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′.Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24.
Immunogen
Synthetic peptide directed towards the N terminal region of human HNF1A
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Quantity
Est. Dispatch/Availability